Scansite is a collection of programs for
predicting phosphorylation events and protein interactions in signaling
pathways. Our main
website is at MIT. This website at St. Jude uses the Hartwell
Center's 280-CPU Linux cluster for performing many motif scans
in parallel, for users with large data sets. With this computational
power, thousands of protein sequences can be scanned in just a
few minutes.
NOTE:
When the cluster is running at maximum capacity, Scansite jobs may pend for hours or even days. If results are not returned within about 5 minutes, this is probably why. Try submitting again a few hours later or the next day.
News: March 21, 2008 The firewall problem has been resolved, and Scansite is running again.
News: March 10, 2008 The Scansite server is down temporarily. Due to a problem with a firewall upgrade, Scansite's results are not being returned to users. We are expecting several weeks of downtime, with a possible fix date of March 24th, 2008.
Motif
Scan in Parallel
Scan
a List of Protein IDs or Accession Numbers
Here
you can upload a list of protein IDs
to scan them for motifs. The IDs can
be from Genpept ("AAH03962" or "159008"),
RefSeq ("NP_000165" or "4504223"),
PIR ("C34223"), Swiss-Prot/TrEMBL
("RB1_RAT" or "P43006"),
or Ensembl ("ENSP00000158526").
Each line should contain an ID and
a database abbreviation separated by
a space, such as "AAH03962 GP".
The abbreviations are GP, RS, PIR,
ST, and EN. See the tutorial for
more details.
High = More selective, Low = More sensitive
Scan
a List of Protein Sequences
You can
upload a list of amino acid sequences
instead of IDs. Give each sequence
a name in order to read the output
correctly. Each line should contain
a name and the sequence using the standard
one-letter abbreviations, such as "MYPROTEIN
MVLEDITKASIPVVQNARCILQEWARNDYS". "X" can
be used for unknown residues, and "U" can
be used for selenocysteine. See the tutorial for
more details.
High = More selective, Low = More sensitive
Referencing Scansite Please use the following
publication to reference Scansite:
Obenauer, J. C., Cantley, L. C. and Yaffe, M. B. (2003) Scansite 2.0:
proteome-wide prediction of cell signaling interactions using
short sequence motifs. Nucleic Acids Res.,31,
3635-41.
High = More selective, Low = More sensitive